PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009630091.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 379aa    MW: 43432.8 Da    PI: 9.5576
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009630091.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++I+++mg  + R +k+c +rw +yl
   XP_009630091.1  4 RQRWRPEEDALLGAYVKQYGPKEWNLISKRMGrtLDRDPKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding33.31.1e-1059103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T eE+ l + + +++G++ Wk+Ia++++ gRt+k +  +w  +
   XP_009630091.1  59 KGSLTLEEQNLVISLQAKYGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.979157IPR017930Myb domain
SMARTSM007176.5E-13355IPR001005SANT/Myb domain
SuperFamilySSF466891.5E-21498IPR009057Homeodomain-like
CDDcd001671.59E-9653No hitNo description
Gene3DG3DSA:1.10.10.605.5E-20660IPR009057Homeodomain-like
PfamPF139215.5E-13767No hitNo description
SMARTSM007173.3E-958106IPR001005SANT/Myb domain
PROSITE profilePS5129417.50458108IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-1561108IPR009057Homeodomain-like
CDDcd001671.88E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MKERQRWRPE EDALLGAYVK QYGPKEWNLI SKRMGRTLDR DPKSCLERWK NYLKPGIKKG  60
SLTLEEQNLV ISLQAKYGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQLKQ LQRSQKLQDY  120
ADPPSVSAVS DGGSPEGAVS GKYDHILETF AEKYVQPKIF VFQPPLPLPA INNIMPNLEP  180
PPVLSLRPVA ITEPVNSTTI APWMNSAANA SSYTPSPSVS LTLTPSEPVL HVHEPVQSDL  240
ALIGRFYPVQ QLGTLIQYCK ELEEGRQNWV QHKKEATWRL NRLEQQLESE KARKRREKME  300
EIEAKMRCLR EEEMAFIGRM EREYKDQLSA LQRDAEAKEA KLIEACSNKQ LKLAELIEKQ  360
TGFHSHVNGV GNIVSKDEH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-15792789MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-1479230112MYB TRANSFORMING PROTEIN
1mse_C9e-15792789C-Myb DNA-Binding Domain
1msf_C9e-15792789C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1292297RKRREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009630091.10.0PREDICTED: protein rough sheath 2 homolog
SwissprotO809311e-102AS1_ARATH; Transcription factor AS1
TrEMBLA0A068U2N00.0A0A068U2N0_COFCA; Uncharacterized protein
STRINGVIT_14s0083g00120.t011e-159(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29332445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.12e-82MYB family protein